DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and pdia7

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_998070.1 Gene:pdia7 / 405841 ZFINID:ZDB-GENE-040426-2238 Length:488 Species:Danio rerio


Alignment Length:101 Identity:33/101 - (32%)
Similarity:50/101 - (49%) Gaps:4/101 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SYFDKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKIDVDENEDLAVQYEV 79
            |.||:   .||.:..:||||||.|||.|..:.|..|..|:...|.:.:.|:|...|.:...::.|
Zfish    28 SDFDR---SAGMHDTLLVEFFAPWCGHCQRLAPEYEAAATKLKGTLALAKVDCTVNSETCERFGV 89

  Fly    80 NSMPTFLIIKNRVTLIQFVG-GNVERVVSTVEKFVG 114
            |..||..|.:|......:.| ...:.:||.::|..|
Zfish    90 NGYPTLKIFRNGEESGAYDGPRTADGIVSYMKKQAG 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 31/96 (32%)
pdia7NP_998070.1 ER_PDI_fam 20..483 CDD:273457 33/101 (33%)
Thioredoxin_like 25..124 CDD:294274 32/98 (33%)
PDI_b_ERp57 127..231 CDD:239367
PDI_b'_ERp72_ERp57 235..348 CDD:239371
PDI_a_PDI_a'_C 368..471 CDD:239293
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.