DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and CG8517

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_611446.3 Gene:CG8517 / 37268 FlyBaseID:FBgn0034472 Length:145 Species:Drosophila melanogaster


Alignment Length:95 Identity:30/95 - (31%)
Similarity:62/95 - (65%) Gaps:2/95 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QKKVIIVDSKSYFDKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKIDVDE 69
            ::.:..|:::..|::.:  ..:::.|:|:|.|:||.||..:.||||.:.|:..||:.:.::|:||
  Fly    28 KQPIFDVETRKDFEQRV--INSDRPVVVDFHASWCCPCKALAPRLENVVSEQEGRVRLARVDIDE 90

  Fly    70 NEDLAVQYEVNSMPTFLIIKNRVTLIQFVG 99
            :.:||:.|.|.|:|:.::|.|...:.:.||
  Fly    91 HGELALDYNVGSVPSLVVISNGKVVNRMVG 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 30/92 (33%)
CG8517NP_611446.3 Thioredoxin_like 36..135 CDD:412351 29/87 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464324
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.