DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and Txndc8

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001004092.1 Gene:Txndc8 / 362525 RGDID:1303121 Length:127 Species:Rattus norvegicus


Alignment Length:125 Identity:33/125 - (26%)
Similarity:63/125 - (50%) Gaps:24/125 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VDSKSYFDKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKIDVDENEDLAV 75
            :.|...|.:|:..|| |:.|:|||.|.|||||.||.|..:.::..| ..::..::|||.:::|..
  Rat     5 IKSMREFKELLGAAG-NRLVVVEFSAQWCGPCKMIAPAFQAMSLQY-RNVMFAQVDVDSSQELTE 67

  Fly    76 QYEVNSMPTFLIIKN--RVT--------------------LIQFVGGNVERVVSTVEKFV 113
            ...:..:|||.:.|:  :||                    :.:|.|.::|::...:::.:
  Rat    68 HCSIQVVPTFQMFKHSRKVTPFSRLKRILCCFRSGPGSKKIFEFQGADIEKLEEKIQELM 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 33/121 (27%)
Txndc8NP_001004092.1 Thioredoxin_like 1..89 CDD:412351 30/85 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.