DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and Trx-2

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_523526.1 Gene:Trx-2 / 34281 FlyBaseID:FBgn0040070 Length:106 Species:Drosophila melanogaster


Alignment Length:100 Identity:43/100 - (43%)
Similarity:70/100 - (70%) Gaps:1/100 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VDSKSYFDKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKIDVDENEDLAV 75
            |..|:..|..:..| :.|.|:::|||||||||.||.|:|.:|::.:...::|||:||||.||:|:
  Fly     5 VKDKADLDGQLTKA-SGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAM 68

  Fly    76 QYEVNSMPTFLIIKNRVTLIQFVGGNVERVVSTVE 110
            :|.::|||||:.:||.|.:.:|.|.|.:|:...::
  Fly    69 EYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIK 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 43/99 (43%)
Trx-2NP_523526.1 TRX_family 18..103 CDD:239245 40/85 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443466
Domainoid 1 1.000 89 1.000 Domainoid score I2685
eggNOG 1 0.900 - - E2759_KOG0907
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I360
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D146939at50557
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 1 1.000 - - mtm998
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X356
109.700

Return to query results.
Submit another query.