DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and CG14221

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001259713.1 Gene:CG14221 / 32961 FlyBaseID:FBgn0031042 Length:586 Species:Drosophila melanogaster


Alignment Length:115 Identity:25/115 - (21%)
Similarity:54/115 - (46%) Gaps:5/115 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SKSYFDKLIDDAGTNKYVLVEFFATWCGPC-AMIGPRLEQLASDYFGRMLVLKIDVDENEDLAVQ 76
            |...|:|.:..:|   .::::.::.||||| .|:| .|.::..:..|..|.|.|....:.....:
  Fly    16 SDEEFEKFLQRSG---LLVLDIYSEWCGPCLGMVG-SLRKIKLELGGDNLQLAICKAGSISYLKR 76

  Fly    77 YEVNSMPTFLIIKNRVTLIQFVGGNVERVVSTVEKFVGKVEDSKEHKSKE 126
            :...|.||::.:.:...:....|.:|.::|:.:.:.:......:.|.|.|
  Fly    77 FNKKSEPTWMFVTSGKAINIMFGTDVPKLVAMITRMLQSTMAKETHLSYE 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 22/98 (22%)
CG14221NP_001259713.1 Thioredoxin_like 11..111 CDD:294274 22/98 (22%)
DUF4746 233..508 CDD:292550
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464332
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.