DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and CG18130

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_572772.1 Gene:CG18130 / 32161 FlyBaseID:FBgn0030359 Length:706 Species:Drosophila melanogaster


Alignment Length:99 Identity:24/99 - (24%)
Similarity:48/99 - (48%) Gaps:5/99 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VLVEFFATWCGPC-AMIGPRLEQLASDYFGRMLVLKIDVDENEDLAVQYEVNSMPTFLIIKNRVT 93
            ::::.::.||||| .|:| .|.::..|..|..|.|.|...:......::...|.|.:|.:.....
  Fly    30 LVLDVYSEWCGPCQGMVG-SLRKIKLDVGGDNLHLAICKSDTITALKRFNKRSEPIWLFVTGGRA 93

  Fly    94 LIQFVGGNVERVVSTVEKFVGKVEDSKEHKSKEG 127
            :....|.:|.::||.:.|   ::|.:.:..|:.|
  Fly    94 VNLLFGSDVPKLVSLLVK---ELEKTMQKSSRPG 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 20/81 (25%)
CG18130NP_572772.1 TRX_NDPK 11..112 CDD:239246 21/85 (25%)
DUF4746 234..556 CDD:292550
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.