DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and dhd

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001284882.1 Gene:dhd / 31444 FlyBaseID:FBgn0011761 Length:107 Species:Drosophila melanogaster


Alignment Length:91 Identity:34/91 - (37%)
Similarity:58/91 - (63%) Gaps:0/91 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DAGTNKYVLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKIDVDENEDLAVQYEVNSMPTFLI 87
            :|..:|.::::|:|||||||..:...::.||..|..:.:|||||||:.|:|..:|:|.|||||:.
  Fly    15 EAADDKLIVLDFYATWCGPCKEMESTVKSLARKYSSKAVVLKIDVDKFEELTERYKVRSMPTFVF 79

  Fly    88 IKNRVTLIQFVGGNVERVVSTVEKFV 113
            ::....|..|.|.:..::.:.:.|.|
  Fly    80 LRQNRRLASFAGADEHKLTNMMAKLV 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 32/87 (37%)
dhdNP_001284882.1 TRX_family 17..93 CDD:239245 31/75 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443465
Domainoid 1 1.000 87 1.000 Domainoid score I5089
eggNOG 1 0.900 - - E2759_KOG0907
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I360
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D146939at50557
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 1 1.000 - - mtm998
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X356
109.700

Return to query results.
Submit another query.