DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and Pdia6

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001004442.1 Gene:Pdia6 / 286906 RGDID:628688 Length:445 Species:Rattus norvegicus


Alignment Length:99 Identity:27/99 - (27%)
Similarity:48/99 - (48%) Gaps:6/99 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KKVIIVDSKSYFDKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLEQLASDY----FGRMLVLKID 66
            ||.::..:...|||.:.|  :....:|||:|.|||.|..:.|.....|::.    .|::.:..:|
  Rat   164 KKDVVELTDDTFDKNVLD--SEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD 226

  Fly    67 VDENEDLAVQYEVNSMPTFLIIKNRVTLIQFVGG 100
            ...|:.||.:|.:...||..|.:...:.:.:.||
  Rat   227 ATVNQVLASRYGIKGFPTIKIFQKGESPVDYDGG 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 25/97 (26%)
Pdia6NP_001004442.1 PDI_a_P5 31..133 CDD:239299
PDI_a_P5 166..271 CDD:239299 25/97 (26%)
P5_C 280..409 CDD:239281
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.