DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and trx1

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_593852.1 Gene:trx1 / 2542084 PomBaseID:SPAC7D4.07c Length:103 Species:Schizosaccharomyces pombe


Alignment Length:100 Identity:34/100 - (34%)
Similarity:60/100 - (60%) Gaps:4/100 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VDSKSYFDKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKIDVDENEDLAV 75
            |...|.|..::..   :|.|:|:|||||||||..|.|:.||.::.|.....: |:|||:..::|.
pombe     5 VSDSSEFKSIVCQ---DKLVVVDFFATWCGPCKAIAPKFEQFSNTYSDATFI-KVDVDQLSEIAA 65

  Fly    76 QYEVNSMPTFLIIKNRVTLIQFVGGNVERVVSTVE 110
            :..|::||:|.:.||...:.:.||.|..::.::::
pombe    66 EAGVHAMPSFFLYKNGEKIEEIVGANPAKLEASIK 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 34/99 (34%)
trx1NP_593852.1 TRX_family 9..100 CDD:239245 33/94 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X356
TreeFam 1 0.960 - -
76.670

Return to query results.
Submit another query.