DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and trx2

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_595954.2 Gene:trx2 / 2539898 PomBaseID:SPBC12D12.07c Length:133 Species:Schizosaccharomyces pombe


Alignment Length:107 Identity:31/107 - (28%)
Similarity:60/107 - (56%) Gaps:4/107 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KKVIIVDSKSYFDKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKIDVDEN 70
            :||..|:|...::..|   ..:|..:|:|:|.|||||..:.|.||:| |:...:...:.::.|:.
pombe    29 RKVNAVESFGDYNTRI---SADKVTVVDFYADWCGPCKYLKPFLEKL-SEQNQKASFIAVNADKF 89

  Fly    71 EDLAVQYEVNSMPTFLIIKNRVTLIQFVGGNVERVVSTVEKF 112
            .|:|.:..|.::||.::.:....|.:.||.:|:.:.|.:.|:
pombe    90 SDIAQKNGVYALPTMVLFRKGQELDRIVGADVKTLSSLLAKY 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 29/102 (28%)
trx2NP_595954.2 TRX_family 39..122 CDD:239245 24/86 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.670

Return to query results.
Submit another query.