powered by:
Protein Alignment CG13473 and trx-4
DIOPT Version :9
Sequence 1: | NP_648717.1 |
Gene: | CG13473 / 39603 |
FlyBaseID: | FBgn0036442 |
Length: | 139 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_491142.1 |
Gene: | trx-4 / 189905 |
WormBaseID: | WBGene00021548 |
Length: | 107 |
Species: | Caenorhabditis elegans |
Alignment Length: | 72 |
Identity: | 37/72 - (51%) |
Similarity: | 54/72 - (75%) |
Gaps: | 0/72 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 VLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKIDVDENEDLAVQYEVNSMPTFLIIKNRVTL 94
|::.|.|:|||||.||.||:|:||:::..|:.:|||||||.:.:..:||:|||||||:|.:.:..
Worm 23 VILFFTASWCGPCQMIKPRVEELAAEHKDRLSILKIDVDECDGVGEEYEINSMPTFLLIVDGIKK 87
Fly 95 IQFVGGN 101
.||.|.|
Worm 88 DQFSGAN 94
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160157678 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0907 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1482186at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000170 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR45663 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
7 | 6.810 |
|
Return to query results.
Submit another query.