DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and trx-4

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_491142.1 Gene:trx-4 / 189905 WormBaseID:WBGene00021548 Length:107 Species:Caenorhabditis elegans


Alignment Length:72 Identity:37/72 - (51%)
Similarity:54/72 - (75%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKIDVDENEDLAVQYEVNSMPTFLIIKNRVTL 94
            |::.|.|:|||||.||.||:|:||:::..|:.:|||||||.:.:..:||:|||||||:|.:.:..
 Worm    23 VILFFTASWCGPCQMIKPRVEELAAEHKDRLSILKIDVDECDGVGEEYEINSMPTFLLIVDGIKK 87

  Fly    95 IQFVGGN 101
            .||.|.|
 Worm    88 DQFSGAN 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 37/72 (51%)
trx-4NP_491142.1 TRX_family 9..103 CDD:239245 37/72 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157678
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45663
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.810

Return to query results.
Submit another query.