DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and trx-1

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001021885.1 Gene:trx-1 / 181863 WormBaseID:WBGene00015062 Length:115 Species:Caenorhabditis elegans


Alignment Length:113 Identity:41/113 - (36%)
Similarity:60/113 - (53%) Gaps:17/113 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KSYFDKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKIDVDENEDLAVQYE 78
            :|.|::||.. ...|.::::|:|||||||..|.|..::||:.:.| ::..|:||||.|||..:|:
 Worm    15 QSDFEQLIRQ-HPEKIIILDFYATWCGPCKAIAPLYKELATTHKG-IIFCKVDVDEAEDLCSKYD 77

  Fly    79 VNSMPTFLIIKNRVTLIQFVGGNVERVVSTVEKFVGKVEDSKEHKSKE 126
            |..||||:..||.               ..:|...|.|||....|..|
 Worm    78 VKMMPTFIFTKNG---------------DAIEALEGCVEDELRQKVLE 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 34/96 (35%)
trx-1NP_001021885.1 Thioredoxin 16..111 CDD:278513 41/112 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 87 1.000 Domainoid score I5089
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X356
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.