DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and trx-2

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001256207.1 Gene:trx-2 / 179434 WormBaseID:WBGene00007099 Length:145 Species:Caenorhabditis elegans


Alignment Length:93 Identity:34/93 - (36%)
Similarity:56/93 - (60%) Gaps:4/93 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VIIVDS-KSYFDKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKIDVDENE 71
            |..:|| :.:.:|:|.   ::..|:|:|.|.|||||..:|||||:..:...|.:|:.||:||...
 Worm    39 VFDIDSVEDFTEKVIQ---SSVPVIVDFHAEWCGPCQALGPRLEEKVNGRQGSVLLAKINVDHAG 100

  Fly    72 DLAVQYEVNSMPTFLIIKNRVTLIQFVG 99
            :||:.|.::::||....||...:..|.|
 Worm   101 ELAMDYGISAVPTVFAFKNGEKISGFSG 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 34/93 (37%)
trx-2NP_001256207.1 TRX_family 46..140 CDD:239245 31/86 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.