DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and Y55F3AR.2

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_500036.2 Gene:Y55F3AR.2 / 176929 WormBaseID:WBGene00021933 Length:254 Species:Caenorhabditis elegans


Alignment Length:139 Identity:51/139 - (36%)
Similarity:66/139 - (47%) Gaps:24/139 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VIIVDSKSYFDKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKIDVDENED 72
            ||:|:..|.||:.. .||..|.|.|:|.|:|||||..|.|....||:.|.|.:. ||:||||...
 Worm     3 VIVVNGDSDFDRKF-SAGNGKAVFVDFTASWCGPCQYIAPIFSDLANQYKGSVF-LKVDVDECRG 65

  Fly    73 LAVQYEVNSMPTFLIIKNRVTLIQFVGGNVERVV-----STVEKFVGKVEDSKEHKSKEG----- 127
            .|..|.||:||||         |.||.|..:..:     |.:...|.|...:....|..|     
 Worm    66 TAATYGVNAMPTF---------IAFVNGQKKATIQGADESGLRSMVAKYASTSAAWSGTGQRLSG 121

  Fly   128 ---GASSAT 133
               |:||:|
 Worm   122 STTGSSSST 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 43/107 (40%)
Y55F3AR.2NP_500036.2 TRX_family 10..103 CDD:239245 40/103 (39%)
DUF4605 157..212 CDD:373801
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157682
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X356
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.