DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and Y49E10.4

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_499613.1 Gene:Y49E10.4 / 176664 WormBaseID:WBGene00013030 Length:436 Species:Caenorhabditis elegans


Alignment Length:185 Identity:45/185 - (24%)
Similarity:67/185 - (36%) Gaps:65/185 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KKVIIVDSKSYFDKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKIDVDEN 70
            |.|::.||.  ||||:  ..:.:..:|||||.|||.|..:.|..::.|.:..||:....:|...:
 Worm   155 KVVVLTDSN--FDKLV--LNSKEPWMVEFFAPWCGHCQKLEPEWKKAAEEMGGRVKFGALDATAH 215

  Fly    71 EDLAVQYEVNSMPTFLII----------------KNRVTLIQF--------------VGGNVERV 105
            |.:|.::.:...||....                :....||.:              |.|..:.|
 Worm   216 ESIAQKFGIRGFPTIKFFAPGTSSASDAEDYQGGRTSTDLISYAESKYDDFGAAPEVVEGTGKAV 280

  Fly   106 VSTVEK--------FVGKVED--SKEHKSK---------------------EGGA 129
            |.||.|        |:..:.|  ||..|.|                     ||||
 Worm   281 VETVCKDKQLCIFTFLPSIFDCQSKCRKQKIDMLNELATIFKKRSFGWVWMEGGA 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 33/132 (25%)
Y49E10.4NP_499613.1 PDI_a_P5 26..127 CDD:239299
PDI_a_P5 156..259 CDD:239299 27/106 (25%)
P5_C 269..405 CDD:239281 17/67 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.