DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and png-1

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_492913.1 Gene:png-1 / 173028 WormBaseID:WBGene00010160 Length:606 Species:Caenorhabditis elegans


Alignment Length:101 Identity:32/101 - (31%)
Similarity:59/101 - (58%) Gaps:1/101 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VDSKSYFDKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKIDVDENEDLAV 75
            |.|....:.:::.:..|:.::::|||.|||||.||.|..||.:::| |....||::.|...|:..
 Worm     6 VGSLPELNNILERSDANRLIIIDFFANWCGPCRMISPIFEQFSAEY-GNATFLKVNCDVARDIVQ 69

  Fly    76 QYEVNSMPTFLIIKNRVTLIQFVGGNVERVVSTVEK 111
            :|.:::||||:.:|||..:....|.|.:.:...:.:
 Worm    70 RYNISAMPTFIFLKNRQQVDMVRGANQQAIAEKIRQ 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 32/99 (32%)
png-1NP_492913.1 TRX_family 20..103 CDD:239245 30/83 (36%)
Transglut_core 204..296 CDD:280085
YebA <235..312 CDD:224224
PAW 407..604 CDD:299187
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.