DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and W01B11.6

DIOPT Version :10

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_491139.1 Gene:W01B11.6 / 171903 WormBaseID:WBGene00020917 Length:109 Species:Caenorhabditis elegans


Alignment Length:104 Identity:27/104 - (25%)
Similarity:44/104 - (42%) Gaps:8/104 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FDKLID-------DAGTNKYVLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKIDVDENEDLA 74
            :|.|.|       :.|..|..:..|:...|..|..|.|..:.|...|....||.......::.|.
 Worm     4 YDCLTDEDFLQKSEHGIGKKAIYYFYGERCPSCESIKPLFDDLCKKYEKTALVYTYPCYNDDQLT 68

  Fly    75 VQ-YEVNSMPTFLIIKNRVTLIQFVGGNVERVVSTVEKF 112
            .. :.||::|||:::.|...:.:.||...|:|....||:
 Worm    69 GDAFAVNAVPTFVVMNNGEEVTRHVGAEAEKVQELFEKY 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 CnoX 7..99 CDD:442352 21/89 (24%)
W01B11.6NP_491139.1 CnoX 7..107 CDD:442352 25/99 (25%)

Return to query results.
Submit another query.