DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and Txn1

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_446252.1 Gene:Txn1 / 116484 RGDID:621157 Length:105 Species:Rattus norvegicus


Alignment Length:105 Identity:41/105 - (39%)
Similarity:64/105 - (60%) Gaps:2/105 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VIIVDSKSYFDKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKIDVDENED 72
            |.:::||..|.:.:..|| :|.|:|:|.|||||||.||.|....|. |.:..::.|::|||:.:|
  Rat     2 VKLIESKEAFQEALAAAG-DKLVVVDFSATWCGPCKMIKPFFHSLC-DKYSNVVFLEVDVDDCQD 64

  Fly    73 LAVQYEVNSMPTFLIIKNRVTLIQFVGGNVERVVSTVEKF 112
            :|...||..||||...|....:.:|.|.|.|::.:|:.:|
  Rat    65 VAADCEVKCMPTFQFYKKGQKVGEFSGANKEKLEATITEF 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 40/102 (39%)
Txn1NP_446252.1 Thioredoxin 2..103 CDD:395038 40/102 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X356
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.680

Return to query results.
Submit another query.