DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and Txn1

DIOPT Version :10

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_446252.1 Gene:Txn1 / 116484 RGDID:621157 Length:105 Species:Rattus norvegicus


Alignment Length:105 Identity:41/105 - (39%)
Similarity:64/105 - (60%) Gaps:2/105 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VIIVDSKSYFDKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKIDVDENED 72
            |.:::||..|.:.:..|| :|.|:|:|.|||||||.||.|....|. |.:..::.|::|||:.:|
  Rat     2 VKLIESKEAFQEALAAAG-DKLVVVDFSATWCGPCKMIKPFFHSLC-DKYSNVVFLEVDVDDCQD 64

  Fly    73 LAVQYEVNSMPTFLIIKNRVTLIQFVGGNVERVVSTVEKF 112
            :|...||..||||...|....:.:|.|.|.|::.:|:.:|
  Rat    65 VAADCEVKCMPTFQFYKKGQKVGEFSGANKEKLEATITEF 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 CnoX 7..99 CDD:442352 36/90 (40%)
Txn1NP_446252.1 Thioredoxin 2..103 CDD:395038 40/102 (39%)

Return to query results.
Submit another query.