DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and PDIA5

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_006801.1 Gene:PDIA5 / 10954 HGNCID:24811 Length:519 Species:Homo sapiens


Alignment Length:105 Identity:28/105 - (26%)
Similarity:50/105 - (47%) Gaps:6/105 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KKVIIVDSKSYFDKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKIDV--D 68
            |.|:.:||:..|.:|:..  ..|.:|:.|:|.||..|..:.|..::.|:...|..::..::|  .
Human   151 KDVVHLDSEKDFRRLLKK--EEKPLLIMFYAPWCSMCKRMMPHFQKAATQLRGHAVLAGMNVYSS 213

  Fly    69 ENEDLAVQYEVNSMPTFLIIKNRVTLIQF--VGGNVERVV 106
            |.|::..:|.|...||....:....|.|:  .|...|.:|
Human   214 EFENIKEEYSVRGFPTICYFEKGRFLFQYDNYGSTAEDIV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 27/103 (26%)
PDIA5NP_006801.1 PDI_b_PDIR_N 28..139 CDD:239365
PDI_a_PDIR 152..256 CDD:239295 27/104 (26%)
PTZ00102 168..512 CDD:240266 22/88 (25%)
PDI_a_PDIR 277..379 CDD:239295
PDI_a_PDIR 398..501 CDD:239295
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 516..519
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.