DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and TXNDC9

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_005774.2 Gene:TXNDC9 / 10190 HGNCID:24110 Length:226 Species:Homo sapiens


Alignment Length:144 Identity:26/144 - (18%)
Similarity:57/144 - (39%) Gaps:22/144 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IVDSKSYFDKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKIDVDENEDLA 74
            |...:.:|.::.:    ::.|:..|:......|.::...|..|:..:. ....||::|::...|.
Human    76 IPSERDFFQEVKE----SENVVCHFYRDSTFRCKILDRHLAILSKKHL-ETKFLKLNVEKAPFLC 135

  Fly    75 VQYEVNSMPTFLIIKNRVTLIQFVG----GNVERVV----------STVEKFVGKVEDSKEHKSK 125
            .:..:..:||..::|:..|....||    ||.:...          |.:..:.|.:.:......|
Human   136 ERLHIKVIPTLALLKDGKTQDYVVGFTDLGNTDDFTTETLEWRLGSSDILNYSGNLMEPPFQNQK 200

  Fly   126 EGGASSATVPKLER 139
            :.|.:   ..|||:
Human   201 KFGTN---FTKLEK 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 20/114 (18%)
TXNDC9NP_005774.2 Phd_like_TxnDC9 68..180 CDD:239287 19/108 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.