DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13473 and XB5961763

DIOPT Version :9

Sequence 1:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001123676.1 Gene:XB5961763 / 100170428 XenbaseID:XB-GENE-5961764 Length:104 Species:Xenopus tropicalis


Alignment Length:89 Identity:32/89 - (35%)
Similarity:52/89 - (58%) Gaps:3/89 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DAGTNKYVLVEFFATWCGPCAMIGPRLEQLASDYFGRMLVLKIDVDENEDLAVQYEVNSMPTFLI 87
            ||| .|.|||.|.:..||.|.::.|..|:|.::| ..:|:.|: :|:...|....|:.|.||||.
 Frog    17 DAG-QKLVLVNFSSHKCGQCTIVAPEYEKLCTEY-PDILLYKV-LDDAPKLCQHCEITSTPTFLF 78

  Fly    88 IKNRVTLIQFVGGNVERVVSTVEK 111
            .|:|:.:.||.|.::.::..|:.|
 Frog    79 YKDRLKIKQFSGADIVQLRETIRK 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13473NP_648717.1 Thioredoxin 8..111 CDD:278513 31/87 (36%)
XB5961763NP_001123676.1 TRX_family 9..100 CDD:239245 30/85 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X356
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.