DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5048 and Dnaaf6

DIOPT Version :9

Sequence 1:NP_648712.1 Gene:CG5048 / 39598 FlyBaseID:FBgn0036437 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_083338.1 Gene:Dnaaf6 / 74708 MGIID:1921958 Length:218 Species:Mus musculus


Alignment Length:202 Identity:62/202 - (30%)
Similarity:101/202 - (50%) Gaps:27/202 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LKMLQGLLNPNQRRGGIDYSSSEDEEESMVVNKMNPGTIGRPNGEDGTAKGKKKKK-PNPLCTPL 73
            |:.|..|||| :...|.|:   |..:.|..:..|.||.||.|       |.|:.|. |.|     
Mouse    37 LQALSSLLNP-EEEDGFDF---EQGQCSFTIGAMGPGNIGPP-------KAKESKAIPEP----- 85

  Fly    74 VEEEKKQPESLEEWQDQQEKEDM---DILESRKTPEYTMTYRQAVGTEDVFLQMGNRTGSSASCE 135
                 :..||...|..::..|..   ||.:.|:.|:|.:.::|.||||||:|.:..:..|:|.|:
Mouse    86 -----RSDESENIWNPEEVPEGAEHDDIWDVREIPDYEIVFQQTVGTEDVYLGLTRKDPSTACCQ 145

  Fly   136 DLILEVSLPDEEMTADKMSLSLQETELDLGTCLYRLRLPLPHPVNVDRCHAKYDSELKKLRLTLR 200
            :|::::.||:  ....::.:.:||..|||.|...:|.:..|.||..:...|.|..|.:.|.:.:.
Mouse   146 ELVVKIKLPN--TNPSEIQIDIQEMLLDLRTPRKKLLVNFPQPVERNSARASYIWEAETLEVRMT 208

  Fly   201 LQRELDY 207
            :||:||:
Mouse   209 VQRDLDF 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5048NP_648712.1 alpha-crystallin-Hsps_p23-like <104..191 CDD:294116 28/86 (33%)
Dnaaf6NP_083338.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 66..103 15/53 (28%)
alpha-crystallin-Hsps_p23-like <146..209 CDD:294116 17/64 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837917
Domainoid 1 1.000 62 1.000 Domainoid score I10285
eggNOG 1 0.900 - - E1_2CJGJ
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H16553
Inparanoid 1 1.050 91 1.000 Inparanoid score I5088
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57044
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007485
OrthoInspector 1 1.000 - - otm42350
orthoMCL 1 0.900 - - OOG6_104720
Panther 1 1.100 - - LDO PTHR21083
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5667
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.