DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5048 and dnaaf6

DIOPT Version :9

Sequence 1:NP_648712.1 Gene:CG5048 / 39598 FlyBaseID:FBgn0036437 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001002309.1 Gene:dnaaf6 / 432386 ZFINID:ZDB-GENE-040722-2 Length:194 Species:Danio rerio


Alignment Length:214 Identity:68/214 - (31%)
Similarity:112/214 - (52%) Gaps:33/214 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SIFDHPEQLKMLQGLLNPNQRRGGIDYSSSEDEEESMVVN---KMNPGTIGRPNGEDGTAKGKKK 63
            |:.|    |:.|..||:..:        .:::|||.:.:.   :|.||.||.|....|..||.  
Zfish     6 SVHD----LQALSALLSKPK--------DNDEEEEDLTLQPMARMGPGHIGPPAAPSGKNKGS-- 56

  Fly    64 KKPNPLCTPLVEEEKKQPESLEEWQDQQEKEDM---DILESRKTPEYTMTYRQAVGTEDVFLQMG 125
                  .:..|::..|     :.|.:.:..|..   |:.:.|..|||.:..:|:|||||:||.:.
Zfish    57 ------TSAYVKKNSK-----DIWDEAEVTEGAHFDDLNDPRPQPEYEIVLKQSVGTEDLFLGLS 110

  Fly   126 NRTGSSASCEDLILEVSLPDEEMTADKMSLSLQETELDLGTCLYRLRLPLPHPVNVDRCHAKYDS 190
            .:..||..||.:::.|.|||.: |:| :.|.::||.|||.|..|:|.|.|||||:....:|::.:
Zfish   111 RKDPSSMCCESMLVRVKLPDTK-TSD-LVLDVRETFLDLRTPKYKLGLHLPHPVHKQEGNARFIT 173

  Fly   191 ELKKLRLTLRLQRELDYVN 209
            |.::|.:||.:.|.:|.:|
Zfish   174 EREELEITLPMNRPMDCIN 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5048NP_648712.1 alpha-crystallin-Hsps_p23-like <104..191 CDD:294116 37/86 (43%)
dnaaf6NP_001002309.1 alpha-crystallin-Hsps_p23-like <45..183 CDD:294116 50/152 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581706
Domainoid 1 1.000 77 1.000 Domainoid score I8850
eggNOG 1 0.900 - - E1_2CJGJ
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H16553
Inparanoid 1 1.050 97 1.000 Inparanoid score I5035
OMA 1 1.010 - - QHG57044
OrthoDB 1 1.010 - - D1561656at2759
OrthoFinder 1 1.000 - - FOG0007485
OrthoInspector 1 1.000 - - oto40868
orthoMCL 1 0.900 - - OOG6_104720
Panther 1 1.100 - - LDO PTHR21083
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5667
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.