DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5048 and Dnaaf6b

DIOPT Version :9

Sequence 1:NP_648712.1 Gene:CG5048 / 39598 FlyBaseID:FBgn0036437 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_808589.1 Gene:Dnaaf6b / 331537 MGIID:3607720 Length:218 Species:Mus musculus


Alignment Length:202 Identity:60/202 - (29%)
Similarity:99/202 - (49%) Gaps:27/202 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LKMLQGLLNPNQRRGGIDYSSSEDEEESMVVNKMNPGTIGRPNGEDGTAKGKKKKK-PNPLCTPL 73
            |:.|..||||.:.    |....|..:.:..:..|.||.||.|       |.|:.|. |.|     
Mouse    37 LQALASLLNPEEE----DDFDFEQGQCTSTIRAMGPGNIGPP-------KAKESKAIPEP----- 85

  Fly    74 VEEEKKQPESLEEWQDQQEK---EDMDILESRKTPEYTMTYRQAVGTEDVFLQMGNRTGSSASCE 135
                 :..||...|..::..   |..||.:.|:.|:|.:.::|.|||||::|.:..:..|:|.|:
Mouse    86 -----RSDESENIWNPEEVPEGGEHDDIWDVREIPDYEIVFQQTVGTEDIYLGLTGKDPSTACCQ 145

  Fly   136 DLILEVSLPDEEMTADKMSLSLQETELDLGTCLYRLRLPLPHPVNVDRCHAKYDSELKKLRLTLR 200
            :|::::.||:  ....::.:.:||..|||.|...:|.:..|.||..:...|.|..|.:.|.:.:.
Mouse   146 ELVVKIKLPN--TNPSEIQIDIQEMLLDLRTPKKKLLVNFPQPVERNSARASYIWEAETLEVRMT 208

  Fly   201 LQRELDY 207
            |||:||:
Mouse   209 LQRDLDF 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5048NP_648712.1 alpha-crystallin-Hsps_p23-like <104..191 CDD:294116 27/86 (31%)
Dnaaf6bNP_808589.1 alpha-crystallin-Hsps_p23-like <146..207 CDD:294116 17/62 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837916
Domainoid 1 1.000 62 1.000 Domainoid score I10285
eggNOG 1 0.900 - - E1_2CJGJ
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H16553
Inparanoid 1 1.050 91 1.000 Inparanoid score I5088
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57044
OrthoDB 1 1.010 - - D1561656at2759
OrthoFinder 1 1.000 - - FOG0007485
OrthoInspector 1 1.000 - - otm42350
orthoMCL 1 0.900 - - OOG6_104720
Panther 1 1.100 - - O PTHR21083
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5667
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.800

Return to query results.
Submit another query.