DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and TMPRSS5

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_110397.2 Gene:TMPRSS5 / 80975 HGNCID:14908 Length:457 Species:Homo sapiens


Alignment Length:413 Identity:131/413 - (31%)
Similarity:184/413 - (44%) Gaps:79/413 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WPLVLAMA------------------SCLLFTAATSATPATPATPATSAPPATSTATSSLSSIP- 54
            |.|||.:.                  ||...:|..:..||.|.|.:...........:.:...| 
Human    66 WLLVLYLCPAASQPISGTLQDEEITLSCSEASAEEALLPALPKTVSFRINSEDFLLEAQVRDQPR 130

  Fly    55 -------GKYQALG-----------AAHHQAKKLKIGDVNASSSDANKPVFRQNPIKNWFGAF-- 99
                   |...|||           ..||  |.:.:.|:..:||..    |.|  :....|.|  
Human   131 WLLVCHEGWSPALGLQICWSLGHLRLTHH--KGVNLTDIKLNSSQE----FAQ--LSPRLGGFLE 187

  Fly   100 ----NRNNSPAAQNQTSPTCSCRCGERNDESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLIND 160
                .|||..:.| ..|..|| .||.|...||||||.:.....:||.|.::...|..|||:::..
Human   188 EAWQPRNNCTSGQ-VVSLRCS-ECGARPLASRIVGGQSVAPGRWPWQASVALGFRHTCGGSVLAP 250

  Fly   161 RYVLTAAHCVKGF------MWFMIKVTFG--EHDRCNDKERP-ETRFVLRAFSQK-FSFSNFDND 215
            |:|:|||||:..|      .|   :|..|  .|...    || :...|.|..... :|..|.|.|
Human   251 RWVVTAAHCMHSFRLARLSSW---RVHAGLVSHSAV----RPHQGALVERIIPHPLYSAQNHDYD 308

  Fly   216 IALLRLNDRVPITSFIRPICLPRVEQRQDLFVGTKAIATGWG-TLKEDGKPSCLLQEVEVPVLDN 279
            :|||||...:..:..:..:|||..||.  ...|::...:||| |.......|.:||:..||:...
Human   309 VALLRLQTALNFSDTVGAVCLPAKEQH--FPKGSRCWVSGWGHTHPSHTYSSDMLQDTVVPLFST 371

  Fly   280 DECVAQTNYTQKMITKNMMCSGYPGVGGR-DSCQGDSGGPLVRLRPDDKRFEQIGIVSWGNGCAR 343
            ..|.:...|: ..:|..|:|:||  :.|| |:||||||||||  .||...:..:|:||||.|||.
Human   372 QLCNSSCVYS-GALTPRMLCAGY--LDGRADACQGDSGGPLV--CPDGDTWRLVGVVSWGRGCAE 431

  Fly   344 PNYPGVYTRVTKYLDWIVENSRD 366
            ||:||||.:|.::||||.:.::|
Human   432 PNHPGVYAKVAEFLDWIHDTAQD 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 91/244 (37%)
Tryp_SPc 128..363 CDD:238113 92/246 (37%)
TMPRSS5NP_110397.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
SRCR_2 116..213 CDD:292133 24/106 (23%)
Tryp_SPc 217..448 CDD:214473 91/244 (37%)
Tryp_SPc 218..451 CDD:238113 92/246 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I4057
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.