DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and Prss8

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_579929.1 Gene:Prss8 / 76560 MGIID:1923810 Length:339 Species:Mus musculus


Alignment Length:281 Identity:91/281 - (32%)
Similarity:139/281 - (49%) Gaps:49/281 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 ESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCV-KGFMWFMIKVTFGEHDRC 188
            :.||.||.:....::||...::|.....|||:|:::::|::||||. :.......:|..|.|.. 
Mouse    42 QPRITGGGSAKPGQWPWQVSITYDGNHVCGGSLVSNKWVVSAAHCFPREHSREAYEVKLGAHQL- 105

  Fly   189 NDKERPETRFVLRAFSQKFSFSNF-----DNDIALLRLNDRVPITSFIRPICLPRVEQRQDLFVG 248
             |....:|  |:...:|..:.|::     ..||||:||:..|..:.:|||||||..  ......|
Mouse   106 -DSYSNDT--VVHTVAQIITHSSYREEGSQGDIALIRLSSPVTFSRYIRPICLPAA--NASFPNG 165

  Fly   249 TKAIATGWGTLK-----EDGKPSCLLQEVEVPVLDNDEC--------VAQTNYTQKMITKNMMCS 300
            .....||||.:.     :..:|   ||::|||::..:.|        |.:..:|   |.::|:|:
Mouse   166 LHCTVTGWGHVAPSVSLQTPRP---LQQLEVPLISRETCSCLYNINAVPEEPHT---IQQDMLCA 224

  Fly   301 GYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTKYLDWI----- 360
            ||. .||:|:|||||||||  ..|.:..:...||||||:.|..||.|||||..:.|..||     
Mouse   225 GYV-KGGKDACQGDSGGPL--SCPMEGIWYLAGIVSWGDACGAPNRPGVYTLTSTYASWIHHHVA 286

  Fly   361 ----------VENSRDGCFCD 371
                      .|:..||..|:
Mouse   287 ELQPRVVPQTQESQPDGHLCN 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 85/251 (34%)
Tryp_SPc 128..363 CDD:238113 86/268 (32%)
Prss8NP_579929.1 Tryp_SPc 45..284 CDD:238113 86/253 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.