DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and TMPRSS2

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001128571.1 Gene:TMPRSS2 / 7113 HGNCID:11876 Length:529 Species:Homo sapiens


Alignment Length:300 Identity:95/300 - (31%)
Similarity:140/300 - (46%) Gaps:69/300 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 NSPAAQNQTSPTCSC-RCG---ERNDESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYV 163
            :|.|..::...:..| .||   ..:.:||||||.:.....:||...|...|...|||::|...::
Human   264 HSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWI 328

  Fly   164 LTAAHCVKGFMWFMIKVTFGEHDRCNDKERP------ETRF--VLRAFSQKFSF----------- 209
            :||||||                     |:|      .|.|  :||   |.|.|           
Human   329 VTAAHCV---------------------EKPLNNPWHWTAFAGILR---QSFMFYGAGYQVEKVI 369

  Fly   210 --SNFD-----NDIALLRLNDRVPITSFIRPICLPR----VEQRQDLFVGTKAIATGWGTLKEDG 263
              .|:|     |||||::|...:.....::|:|||.    ::..|..::      :|||..:|.|
Human   370 SHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWI------SGWGATEEKG 428

  Fly   264 KPSCLLQEVEVPVLDNDECVAQTNYTQKMITKNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKR 328
            |.|.:|...:|.:::...|.::..| ..:||..|:|:|:. .|..||||||||||||..:  :..
Human   429 KTSEVLNAAKVLLIETQRCNSRYVY-DNLITPAMICAGFL-QGNVDSCQGDSGGPLVTSK--NNI 489

  Fly   329 FEQIGIVSWGNGCARPNYPGVYTRVTKYLDWIVENSR-DG 367
            :..||..|||:|||:...||||..|..:.|||....| ||
Human   490 WWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 84/262 (32%)
Tryp_SPc 128..363 CDD:238113 85/264 (32%)
TMPRSS2NP_001128571.1 DUF3824 <44..91 CDD:289625
LDLa 150..185 CDD:238060
SRCR_2 190..283 CDD:292133 4/18 (22%)
Tryp_SPc 292..521 CDD:214473 84/262 (32%)
Tryp_SPc 293..524 CDD:238113 85/264 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I4057
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8579
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.