DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and Prss55

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_036014741.1 Gene:Prss55 / 71037 MGIID:1918287 Length:347 Species:Mus musculus


Alignment Length:265 Identity:83/265 - (31%)
Similarity:123/265 - (46%) Gaps:40/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 SCRCG------ERNDESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCVKGFM 174
            |..||      .|...|||:.|....:.|:||...:...:..:|||:::::.::||.|||     
Mouse    43 SSECGVRPLYDSRIQYSRIIEGQEAELGEFPWQVSIQESDHHFCGGSILSEWWILTVAHC----- 102

  Fly   175 WFM--------IKVTFGEHDRCNDKERPETRFVLRAFSQKFSFSNFDNDIALLRLNDRVPITSFI 231
             |.        ::|..|.:|........|...::|  .:.|...|.|||||||.|...:......
Mouse   103 -FYAQELSPTDLRVRVGTNDLTTSPVELEVTTIIR--HKGFKRLNMDNDIALLLLAKPLTFNELT 164

  Fly   232 RPICLPRVEQRQDLFVGT----KAIATGWGTLKEDGKPSCLLQEVEVP--VLDNDECVAQTNYTQ 290
            .|||||       |:...    :....|||......|.|.....::||  :::.:||:...    
Mouse   165 VPICLP-------LWPAPPSWHECWVAGWGVTNSTDKESMSTDLMKVPMRIIEWEECLQMF---- 218

  Fly   291 KMITKNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTK 355
            ..:|.||:|:.| |....|:||||||||||.......|:.|:||:|||..|.:..:||:||.:.|
Mouse   219 PSLTTNMLCASY-GNESYDACQGDSGGPLVCTTDPGSRWYQVGIISWGKSCGKKGFPGIYTVLAK 282

  Fly   356 YLDWI 360
            |..||
Mouse   283 YTLWI 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 76/246 (31%)
Tryp_SPc 128..363 CDD:238113 77/247 (31%)
Prss55XP_036014741.1 Tryp_SPc 60..287 CDD:214473 76/246 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BMSX
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.