DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and Prss41

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_036016678.1 Gene:Prss41 / 71003 MGIID:1918253 Length:353 Species:Mus musculus


Alignment Length:285 Identity:105/285 - (36%)
Similarity:146/285 - (51%) Gaps:41/285 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 NRNNSPAAQNQTS--PTCSCRCGERND-ESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDR 161
            :|..|.||..:::  ...|..||.||| .||||||..:....:||.|.|.......|||:|::.|
Mouse    53 SREESQAADLKSTDIKLLSMPCGRRNDTRSRIVGGIESMQGRWPWQASLRLKKSHRCGGSLLSRR 117

  Fly   162 YVLTAAHCVKGFM----WFMIKVTFGEHDRCNDKERPETRFVLRAFSQKFSFSNF---------D 213
            :|||||||.:.::    |   .|..|:   ...|.....|   :|:|.::...:.         .
Mouse   118 WVLTAAHCFRKYLDPEKW---TVQLGQ---LTSKPSYWNR---KAYSGRYRVKDIIVNSEDKLKS 173

  Fly   214 NDIALLRLNDRVPITSFIRPICLPR---VEQRQDLFVGTKAIATGWGTLKEDGK---PSCLLQEV 272
            :|:|||||...|.....|:|:|:..   ..|.|     .:...||||.|:||.|   |...|:||
Mouse   174 HDLALLRLASSVTYNKDIQPVCVQPSTFTSQHQ-----PRCWVTGWGVLQEDLKPLPPPYHLREV 233

  Fly   273 EVPVLDNDEC--VAQTNYTQKMITKNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIGIV 335
            :|.:|:|..|  :.:......:|||::.|:|... |..|:|.||||||||...  |..:.|||||
Mouse   234 QVSILNNSRCQELFEIFSLHHLITKDVFCAGAED-GSADTCSGDSGGPLVCNM--DGLWYQIGIV 295

  Fly   336 SWGNGCARPNYPGVYTRVTKYLDWI 360
            |||.||.|||.||:||.|:.|.:||
Mouse   296 SWGIGCGRPNLPGIYTNVSHYYNWI 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 92/253 (36%)
Tryp_SPc 128..363 CDD:238113 93/254 (37%)
Prss41XP_036016678.1 Tryp_SPc 84..321 CDD:238113 93/254 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.