DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and Prss55

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_008769022.1 Gene:Prss55 / 683415 RGDID:1586875 Length:321 Species:Rattus norvegicus


Alignment Length:261 Identity:84/261 - (32%)
Similarity:125/261 - (47%) Gaps:38/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 CG------ERNDESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCVKGFMWFM 177
            ||      .|...|||:||....|.|:||...:...:..:|||:::::.::||.|||      |.
  Rat    20 CGVRPLYDSRIGHSRIIGGQEAEVGEFPWQVSIQENDHHFCGGSILSEWWILTVAHC------FY 78

  Fly   178 --------IKVTFGEHDRCNDKERPETRFVLRAFSQKFSFSNFDNDIALLRLNDRVPITSFIRPI 234
                    :.|..|.:|........:...::|  .:.|...:.|||||||.|.:.:.......||
  Rat    79 SQELSPTELTVRVGTNDLTTSPMELQVTNIIR--HKDFKRHSMDNDIALLLLANPLTFNEQTVPI 141

  Fly   235 CL---PRVEQRQDLFVGTKAIATGWGTLKEDGKPSCLLQEVEVP--VLDNDECVAQTNYTQKMIT 294
            |:   |.....|:.:|      .||||.....|.|..:..::||  :.|..||:    .....:|
  Rat   142 CMPLQPTPPSWQECWV------AGWGTTNSADKESMNMDLMKVPMRITDWKECL----QLFPSLT 196

  Fly   295 KNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTKYLDW 359
            .||:|:.| |....|:||||||||||..:..|.|:.|:||:|||..|.:...||:||.:..|:.|
  Rat   197 TNMLCASY-GNESFDACQGDSGGPLVCNQESDGRWYQVGIISWGKSCGQKGSPGIYTVLANYILW 260

  Fly   360 I 360
            |
  Rat   261 I 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 78/245 (32%)
Tryp_SPc 128..363 CDD:238113 79/246 (32%)
Prss55XP_008769022.1 Tryp_SPc 35..264 CDD:238113 79/246 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BMSX
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.