DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and f9b

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001035400.1 Gene:f9b / 678552 ZFINID:ZDB-GENE-060421-7346 Length:507 Species:Danio rerio


Alignment Length:335 Identity:108/335 - (32%)
Similarity:171/335 - (51%) Gaps:50/335 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 TSTATSSLSSIPG-KYQALGAAHHQAKKLKIGDVNASSSDANKPVFRQNPIKNWFGAFNRNNSPA 106
            |.....::|.|.| :|...     ::....:.::|::|:..|             ...|.::||.
Zfish   196 TVNQNQTISHINGTEYNTT-----ESSPTDLSEMNSTSTPRN-------------SLQNVSSSPI 242

  Fly   107 AQNQTSPTCSCRCGERNDESRIVGGTTTGVSEYPW-MARLSYFNRF-YCGGTLINDRYVLTAAHC 169
            ..|..:.|        |::.|||||......|.|| :..|...|:. :|||:|:::.:|:|||||
Zfish   243 LTNINNTT--------NNKYRIVGGDEAIPGEIPWQVVFLEKVNKIVFCGGSLLSEEWVITAAHC 299

  Fly   170 VKGFMW-FMIKVTFGEHDRCNDKERPETRFVLRAF-------SQKFSFSNFDNDIALLRLNDRVP 226
            |:|... |.|:|  |||| .:..|..|:...:..:       ||:   |.:::|||||:|...|.
Zfish   300 VEGKQGSFFIRV--GEHD-VSKMEGTESDHGIEEYHIHPRYNSQR---SLYNHDIALLKLKKPVI 358

  Fly   227 ITSFIRPICLPRVEQRQDLFVGTK-AIATGWGTLKEDGKPSCLLQEVEVPVLDNDECVAQTNYTQ 290
            :..:..||||...:..::|....: ::.:|||.|:..|..|.:||:||:|.:|..:|...:.   
Zfish   359 LFDYAVPICLGSKDFTENLLQSAENSLVSGWGRLRYGGIESNVLQKVELPYVDRIKCKGSST--- 420

  Fly   291 KMITKNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTK 355
            ..|::.|.|:||..| .:|:||||||||.. .|..|..| ..||||||..||:....|:|||::|
Zfish   421 DSISRFMFCAGYSTV-RKDACQGDSGGPHA-TRYKDTWF-LTGIVSWGEECAKEGKYGIYTRISK 482

  Fly   356 YLDWIVENSR 365
            |:.||...:|
Zfish   483 YMAWITNITR 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 91/243 (37%)
Tryp_SPc 128..363 CDD:238113 92/245 (38%)
f9bNP_001035400.1 GLA 23..86 CDD:214503
EGF_CA 88..124 CDD:238011
FXa_inhibition 131..167 CDD:291342
Tryp_SPc 255..487 CDD:214473 91/243 (37%)
Tryp_SPc 256..490 CDD:238113 92/245 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.