DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and PRSS22

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_071402.1 Gene:PRSS22 / 64063 HGNCID:14368 Length:317 Species:Homo sapiens


Alignment Length:261 Identity:86/261 - (32%)
Similarity:132/261 - (50%) Gaps:35/261 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 CGERNDESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCVKGFM--WFMIKVT 181
            ||:....:|:|||..:..||:||:..:......:|.|:|:..|:|:|||||.|..:  .::..|.
Human    41 CGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRWVITAAHCFKDNLNKPYLFSVL 105

  Fly   182 FGEHDRCNDKERPETRFVLRAFSQKFSFSNFD------------NDIALLRLNDRVPITSFIRPI 234
            .|.....|...|          |||...:..:            .||||:||...:..:..:.||
Human   106 LGAWQLGNPGSR----------SQKVGVAWVEPHPVYSWKEGACADIALVRLERSIQFSERVLPI 160

  Fly   235 CLPRVEQRQDLFVGTKAIATGWGTLKEDGKP---SCLLQEVEVPVLDNDEC--VAQTNYTQKMIT 294
            |||  :....|...|....:|||:: :||.|   ...||:::||::|::.|  :......|..||
Human   161 CLP--DASIHLPPNTHCWISGWGSI-QDGVPLPHPQTLQKLKVPIIDSEVCSHLYWRGAGQGPIT 222

  Fly   295 KNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTKYLDW 359
            ::|:|:||. .|.||:|.|||||||  :...|..:...||:|||.|||..|.||||..::.:..|
Human   223 EDMLCAGYL-EGERDACLGDSGGPL--MCQVDGAWLLAGIISWGEGCAERNRPGVYISLSAHRSW 284

  Fly   360 I 360
            :
Human   285 V 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 83/251 (33%)
Tryp_SPc 128..363 CDD:238113 83/252 (33%)
PRSS22NP_071402.1 Tryp_SPc 50..288 CDD:238113 83/252 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.