DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and Prss21

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_065233.2 Gene:Prss21 / 57256 MGIID:1916698 Length:324 Species:Mus musculus


Alignment Length:268 Identity:106/268 - (39%)
Similarity:144/268 - (53%) Gaps:48/268 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 CGERNDESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCVK----GFMWFMIK 179
            ||.|...||||||....:..:||...|..:....||.||:|.|:|||||||.:    .|.|   .
Mouse    46 CGHRTIPSRIVGGDDAELGRWPWQGSLRVWGNHLCGATLLNRRWVLTAAHCFQKDNDPFDW---T 107

  Fly   180 VTFGEHDRCNDKERPETRFVLRAFSQKFSFSN----------FDNDIALLRLNDRVPITSFIRPI 234
            |.|||.     ..|| :.:.|:|:|.::...:          :.||||||:|:..|...:||:||
Mouse   108 VQFGEL-----TSRP-SLWNLQAYSNRYQIEDIFLSPKYSEQYPNDIALLKLSSPVTYNNFIQPI 166

  Fly   235 CL----PRVEQRQDLFVGTKAIATGWGTLKED-GKPS-CLLQEVEVPVLDNDECVAQTNYTQKM- 292
            ||    .:.|.|.|.:|      ||||.:.|| ..|| ..||||:|.:::|..|    |:..|. 
Mouse   167 CLLNSTYKFENRTDCWV------TGWGAIGEDESLPSPNTLQEVQVAIINNSMC----NHMYKKP 221

  Fly   293 -----ITKNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTR 352
                 |..:|:|:|.| .||:|:|.|||||||.  ...|..:.|:|:||||.||.|||.|||||.
Mouse   222 DFRTNIWGDMVCAGTP-EGGKDACFGDSGGPLA--CDQDTVWYQVGVVSWGIGCGRPNRPGVYTN 283

  Fly   353 VTKYLDWI 360
            ::.:.:||
Mouse   284 ISHHYNWI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 100/258 (39%)
Tryp_SPc 128..363 CDD:238113 101/259 (39%)
Prss21NP_065233.2 Tryp_SPc 54..291 CDD:214473 100/258 (39%)
Tryp_SPc 55..294 CDD:238113 101/259 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.