powered by:
Protein Alignment CG4914 and AgaP_AGAP012035
DIOPT Version :9
Sequence 1: | NP_648711.1 |
Gene: | CG4914 / 39597 |
FlyBaseID: | FBgn0036436 |
Length: | 374 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_001689264.1 |
Gene: | AgaP_AGAP012035 / 5668016 |
VectorBaseID: | AGAP012035 |
Length: | 197 |
Species: | Anopheles gambiae |
Alignment Length: | 46 |
Identity: | 17/46 - (36%) |
Similarity: | 20/46 - (43%) |
Gaps: | 5/46 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 96 FGAFNRNNSPAAQNQTSPTCSCRCGERNDESRIVGGTTTGVSEYPW 141
||....|.:....|.:|..| .|.||. |:||..||..|. |.|
Mosquito 30 FGQRRVNQACILANGSSGRC-IRIGEC---SKIVELTTRNVL-YSW 70
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.