DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and PRSS8

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens


Alignment Length:269 Identity:88/269 - (32%)
Similarity:129/269 - (47%) Gaps:51/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 CGERNDESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCVKGFMWFMIKVTFG 183
            ||.. .::||.||::....::||...::|.....|||:|:::::||:||||..           .
Human    37 CGVA-PQARITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFP-----------S 89

  Fly   184 EHDRCNDKERPETRF---VLRAFSQKFSFSNF--------------DNDIALLRLNDRVPITSFI 231
            ||    .||..|.:.   .|.::|:....|..              ..|||||:|:..:..:.:|
Human    90 EH----HKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYI 150

  Fly   232 RPICLPRVEQRQDLFVGTKAIATGWGTLKED-----GKPSCLLQEVEVPVLDNDECVAQTNYTQK 291
            ||||||..  ......|.....||||.:...     .||   ||::|||::..:.|....|...|
Human   151 RPICLPAA--NASFPNGLHCTVTGWGHVAPSVSLLTPKP---LQQLEVPLISRETCNCLYNIDAK 210

  Fly   292 -----MITKNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIGIVSWGNGCARPNYPGVYT 351
                 .:.::|:|:||. .||:|:|||||||||  ..|.:..:...||||||:.|...|.|||||
Human   211 PEEPHFVQEDMVCAGYV-EGGKDACQGDSGGPL--SCPVEGLWYLTGIVSWGDACGARNRPGVYT 272

  Fly   352 RVTKYLDWI 360
            ..:.|..||
Human   273 LASSYASWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 84/259 (32%)
Tryp_SPc 128..363 CDD:238113 85/260 (33%)
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 84/259 (32%)
Tryp_SPc 45..284 CDD:238113 85/260 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.