DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and zgc:112285

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001020685.1 Gene:zgc:112285 / 561476 ZFINID:ZDB-GENE-050913-132 Length:316 Species:Danio rerio


Alignment Length:267 Identity:90/267 - (33%)
Similarity:126/267 - (47%) Gaps:32/267 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 CG----ERNDESRIVGGTTTGVSEYPWMARLSYFNR------FYCGGTLINDRYVLTAAHCV-KG 172
            ||    :.|...|||.|.......:||...|....|      ..||||||:..:|||||||. ||
Zfish    46 CGLAHFKPNTVERIVSGNEARPHSWPWQVSLQVRPRGSKHYVHVCGGTLIHKNWVLTAAHCFQKG 110

  Fly   173 -----FMWFMIKVTFGEHD--RCNDKER--PETRFVLRAFSQKFSFSNFDNDIALLRLNDRVPIT 228
                 ..|   ::..|:|.  |....||  |..|.......:..:.|..|.||||::....:..:
Zfish   111 KAEDASSW---RIVLGKHQLKRSETAERFFPVKRIYRHEHFRYPAHSELDYDIALVKAATDIQPS 172

  Fly   229 SFIRPICLPRVEQRQDLFVGTKAIATGWGTL---KEDGKPSCLLQEVEVPVLDNDECVAQTNYTQ 290
            :|||..||||  ::.:|..|.....||||..   ||:...:..|.:..:|::|...| .|..:..
Zfish   173 NFIRYACLPR--KQINLNPGHYCWVTGWGDTRGGKENVSLAEALNQARLPIIDYKTC-RQKKFWG 234

  Fly   291 KMITKNMMCSGYPGVGGRD-SCQGDSGGPLVRLRPDDKRFEQIGIVSWGN-GCARPNYPGVYTRV 353
            ..:..:|:|:|:....|.. :|||||||||: .:....|:|..||||:|. ||...|.|.|:||.
Zfish   235 DRVRDSMICAGFRDTEGTPAACQGDSGGPLL-CQVGRDRWEVHGIVSFGPIGCTVENKPSVFTRT 298

  Fly   354 TKYLDWI 360
            ..|:.||
Zfish   299 AAYIPWI 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 85/253 (34%)
Tryp_SPc 128..363 CDD:238113 86/254 (34%)
zgc:112285NP_001020685.1 Tryp_SPc 58..305 CDD:214473 85/253 (34%)
Tryp_SPc 59..308 CDD:238113 86/254 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.