DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and zgc:100868

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_005164187.1 Gene:zgc:100868 / 554458 ZFINID:ZDB-GENE-040801-33 Length:654 Species:Danio rerio


Alignment Length:291 Identity:106/291 - (36%)
Similarity:137/291 - (47%) Gaps:74/291 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 CGERNDESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCVKGFMWFMIKVTFG 183
            ||.....||||||....|..:||...|......:|||:|||::::||||||.             
Zfish    28 CGTAPLNSRIVGGQNAPVGAWPWQVSLQRDGSHFCGGSLINNQWILTAAHCF------------- 79

  Fly   184 EHDRCNDKERPETRFVL-----------RAFSQKFSFSNF-----------DNDIALLRLNDRVP 226
                    ..|.|..:|           .::|...:.||.           ||||.||:|...|.
Zfish    80 --------PNPSTTGLLVYLGLQKLASFESYSMSSAVSNIIKHPNYNSDTEDNDITLLQLASTVS 136

  Fly   227 ITSFIRPICLPRVEQRQDLFVGTKAIATGWG------TLKEDGKPSCLLQEVEVPVLDNDECVAQ 285
            .:::||||||...:  ...|.||....||||      :|...|    .||||:||::.|.:|  .
Zfish   137 FSNYIRPICLAASD--STFFNGTLVWITGWGNTATGVSLPSPG----TLQEVQVPIVGNRKC--N 193

  Fly   286 TNYTQKMITKNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIGIVSWGNGCARPNYPGVY 350
            ..|....||.||:|:|.. .||:||||||||||:|  ......:.|.||||:|.|||:||:||||
Zfish   194 CLYGVSKITDNMVCAGLL-QGGKDSCQGDSGGPMV--SKQGSVWIQSGIVSFGTGCAQPNFPGVY 255

  Fly   351 TRVTKYLDWIVE--------------NSRDG 367
            |||:||..||.:              |..||
Zfish   256 TRVSKYQSWIQQRITTTQPGFVMYNSNGTDG 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 98/260 (38%)
Tryp_SPc 128..363 CDD:238113 99/276 (36%)
zgc:100868XP_005164187.1 Tryp_SPc 36..265 CDD:214473 98/260 (38%)
Tryp_SPc 37..267 CDD:238113 99/261 (38%)
Tryp_SPc 331..509 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.