DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and zgc:112038

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001018482.1 Gene:zgc:112038 / 553673 ZFINID:ZDB-GENE-050522-271 Length:311 Species:Danio rerio


Alignment Length:264 Identity:104/264 - (39%)
Similarity:146/264 - (55%) Gaps:39/264 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 CGER--NDESRIVGGTTTGVSEYPWMA---RLSYFNRFYCGGTLINDRYVLTAAHCVKGFMWFMI 178
            ||:.  |:.:   ||.......:||.|   |:|..:.. |||:|||..:||:||||      |||
Zfish    27 CGQAPLNNNN---GGDDAVAGSWPWQASIHRISPEDHI-CGGSLINKDWVLSAAHC------FMI 81

  Fly   179 KVT----------FGEHDRCNDKERPETRFVLRAFSQKFSFSNFDNDIALLRLNDRVPITSFIRP 233
            ..|          |......|:..|..|:.|:.   ..:|.:..:||||||||:..|..|.:|||
Zfish    82 TATANIKIFLGRQFQTGSNPNEISRTLTQIVIH---PDYSTTTQNNDIALLRLSSSVTFTDYIRP 143

  Fly   234 ICLPRVEQRQDLFV-GTKAIATGWGTLK-EDGKPSCLLQEVEVPVLDNDECVAQTNYTQKMITKN 296
            :||...:   .:|. |||:..|||...: .|.:.:.:||||::||:.|.||.|  :| :.:||.|
Zfish   144 VCLASAD---SVFAGGTKSWITGWDKHRSSDIQVTNVLQEVQLPVVSNTECNA--DY-KGIITDN 202

  Fly   297 MMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTKYLDWIV 361
            |:|:|. ..||:|:||||||||:|  ..:..|:.|.||||:|..|..|.|||:||||::|..||.
Zfish   203 MICAGI-NEGGKDACQGDSGGPMV--SQNGSRWIQSGIVSFGRECGLPRYPGIYTRVSQYQSWIT 264

  Fly   362 ENSR 365
            ...|
Zfish   265 SELR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 98/247 (40%)
Tryp_SPc 128..363 CDD:238113 100/249 (40%)
zgc:112038NP_001018482.1 Tryp_SPc 37..263 CDD:214473 98/244 (40%)
Tryp_SPc 37..263 CDD:238113 98/244 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.