DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and LOC548809

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001016055.2 Gene:LOC548809 / 548809 -ID:- Length:334 Species:Xenopus tropicalis


Alignment Length:290 Identity:95/290 - (32%)
Similarity:136/290 - (46%) Gaps:62/290 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 SPAAQNQTSPTCSCR-CGERNDESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAA 167
            ||.....|  |.|.| ||.....|||||||......:||...|.|.....|||::|::::::|||
 Frog    35 SPTVSQNT--TASPRICGSPLVSSRIVGGTDATNGAWPWQISLRYKGSHICGGSVISNQWIMTAA 97

  Fly   168 HCVKGFMWFMIKVTFGEHDRCNDKERPETRFVLRAF-------------------SQKFSFSNFD 213
            ||.             |:.|...    :.:.:|.|:                   :..|:.....
 Frog    98 HCF-------------EYSRTPS----DYQVLLGAYQLSVASASELLSSVARVIVNPSFTIPGGP 145

  Fly   214 NDIALLRLNDRVPITSFIRPICLPRVEQRQDLFVGTKAIATGWGTLKEDGKPSCL-----LQEVE 273
            .|||||:|...|..|.:|.|:|:|  ......:.|.:...||||.:   |....|     ||:|.
 Frog   146 GDIALLKLTSPVAYTEYILPVCVP--SSASGFYEGMQCWVTGWGNI---GSAVTLPYPQTLQQVM 205

  Fly   274 VPVLDNDECVAQTNYTQK-------MITKNMMCSGYPGVGGRDSCQGDSGGPLV-RLRPDDKRFE 330
            .|::....| .|..:.|.       ::.|:.:|:|| ..|.:|||||||||||| :|:   ..:.
 Frog   206 TPLISWSTC-NQMYHVQSGISSNIAIVPKDQICAGY-AAGQKDSCQGDSGGPLVCQLQ---GVWY 265

  Fly   331 QIGIVSWGNGCARPNYPGVYTRVTKYLDWI 360
            ||||||||:|||:.:.|||||.|..:..|:
 Frog   266 QIGIVSWGDGCAQASRPGVYTLVPNFKSWL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 85/264 (32%)
Tryp_SPc 128..363 CDD:238113 85/265 (32%)
LOC548809NP_001016055.2 Tryp_SPc 57..294 CDD:214473 85/263 (32%)
Tryp_SPc 58..297 CDD:238113 85/265 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 183 1.000 Inparanoid score I3837
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.