DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and Tpsab1

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_062195.2 Gene:Tpsab1 / 54271 RGDID:3066 Length:310 Species:Rattus norvegicus


Alignment Length:265 Identity:98/265 - (36%)
Similarity:135/265 - (50%) Gaps:60/265 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 IVGGTTTGVSEYPWMARL----SYFNRFYCGGTLINDRYVLTAAHCV---------------KGF 173
            ||||.....:::||...|    :|:..| |||:||:.::||||||||               |.:
  Rat    66 IVGGQEASGNKWPWQVSLRVNDTYWMHF-CGGSLIHPQWVLTAAHCVGPNKADPNKLRVQLRKQY 129

  Fly   174 MWFMIKVTFGEHDRCNDKERPETRFVLRAFSQKFSFSNF-----DNDIALLRLNDRVPITSFIRP 233
            :::        ||.            |...||..|..:|     ..|||||:|.:.|.|||.:..
  Rat   130 LYY--------HDH------------LLTVSQIISHPDFYIAQDGADIALLKLTNPVNITSNVHT 174

  Fly   234 ICLPRVEQRQDLFVGTKAIATGWGTLKEDGK--PSCLLQEVEVPVLDNDECVAQ------TNYTQ 290
            :.||...  :....||....||||.:..|..  |...|:||:||:::|..|..:      |....
  Rat   175 VSLPPAS--ETFPSGTLCWVTGWGNINNDVSLPPPFPLEEVQVPIVENRLCDLKYHKGLNTGDNV 237

  Fly   291 KMITKNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTK 355
            .::..:|:|:|..   |.|||||||||||| .:.:| .:.|.|:||||.|||:||.||:|||||.
  Rat   238 HIVRDDMLCAGNE---GHDSCQGDSGGPLV-CKVED-TWLQAGVVSWGEGCAQPNRPGIYTRVTY 297

  Fly   356 YLDWI 360
            |||||
  Rat   298 YLDWI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 96/263 (37%)
Tryp_SPc 128..363 CDD:238113 98/265 (37%)
Tpsab1NP_062195.2 Tryp_SPc 66..302 CDD:214473 96/263 (37%)
Tryp_SPc 66..302 CDD:238113 96/263 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.