DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and C1s1

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001091086.1 Gene:C1s1 / 50908 MGIID:1355312 Length:694 Species:Mus musculus


Alignment Length:290 Identity:95/290 - (32%)
Similarity:134/290 - (46%) Gaps:63/290 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 PTCSCRCGERND----ESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCVK-- 171
            |.|...||...:    ..||.||....:..:||..   :||.....|.|||:.:||||||.::  
Mouse   425 PRCIPACGVPTEPFQVHQRIFGGQPAKIENFPWQV---FFNHPRASGALINEYWVLTAAHVLEKI 486

  Fly   172 -------GFMWFMIKVTFGE------------HDRCNDKERPETRFVLRAFSQKFSFSNFDNDIA 217
                   |.|  .::.|..|            |.....::.|.||            :|||||||
Mouse   487 SDPLMYVGTM--SVRTTLLENAQRLYSKRVFIHPSWKKEDDPNTR------------TNFDNDIA 537

  Fly   218 LLRLNDRVPITSFIRPICLPRVEQRQDLFVGTKAIATGWGTLKEDGKPSCL-LQEVEVPVLDNDE 281
            |::|.|.|.:...:.|||||......::..|...:.:|||:.::  |...: |:..:|||...:.
Mouse   538 LVQLKDPVKMGPKVSPICLPGTSSEYNVSPGDMGLISGWGSTEK--KVFVINLRGAKVPVTSLET 600

  Fly   282 C--VAQTNYTQK----MITKNMMCSGYPGVGGRDSCQGDSGGPLVRLRPD--DKRFEQIGIVSWG 338
            |  |.:.|.|.:    :.|.||:|:|..||   |||.|||||......|:  ..:|...|:||||
Mouse   601 CKQVKEENPTVRPEDYVFTDNMICAGEKGV---DSCHGDSGGAFAFQVPNVTVPKFYVAGLVSWG 662

  Fly   339 NGCARPNYPGVYTRVTKYLDWIV----ENS 364
            ..|.  .| ||||:|..|:|||:    |||
Mouse   663 KRCG--TY-GVYTKVKNYVDWILKTMQENS 689

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 86/262 (33%)
Tryp_SPc 128..363 CDD:238113 87/268 (32%)
C1s1NP_001091086.1 CUB 24..135 CDD:238001
FXa_inhibition 149..177 CDD:373209
CUB 181..293 CDD:366096
CCP 307..361 CDD:153056
CCP 365..428 CDD:153056 1/2 (50%)
Tryp_SPc 443..681 CDD:214473 86/262 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7195
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.