DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and Tmprss2

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_056590.2 Gene:Tmprss2 / 50528 MGIID:1354381 Length:490 Species:Mus musculus


Alignment Length:282 Identity:95/282 - (33%)
Similarity:136/282 - (48%) Gaps:49/282 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 SPTCSCR---------CGERN--DESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLT 165
            |.:||.|         ||.|:  .:||||||......::||...|.......|||::|...:::|
Mouse   227 SDSCSSRMVVSLRCIECGVRSVKRQSRIVGGLNASPGDWPWQVSLHVQGVHVCGGSIITPEWIVT 291

  Fly   166 AAHCVKGFMWFMIKVTFGEHDRCNDKERPETRF--VLR----------AFSQKFSFSNFD----- 213
            |||||:..:               ...|..|.|  :||          ...:..|..|:|     
Mouse   292 AAHCVEEPL---------------SSPRYWTAFAGILRQSLMFYGSRHQVEKVISHPNYDSKTKN 341

  Fly   214 NDIALLRLNDRVPITSFIRPICLPRVEQRQDLFVGTKAIATGWGTLKEDGKPSCLLQEVEVPVLD 278
            |||||::|...:.....::|:|||......||  ..:...:|||...|.||.|.:|....||:::
Mouse   342 NDIALMKLQTPLAFNDLVKPVCLPNPGMMLDL--DQECWISGWGATYEKGKTSDVLNAAMVPLIE 404

  Fly   279 NDECVAQTNYTQKMITKNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIGIVSWGNGCAR 343
            ..:|.::..| ..:||..|:|:|:. .|..||||||||||||.|:  :..:..||..|||:|||:
Mouse   405 PSKCNSKYIY-NNLITPAMICAGFL-QGSVDSCQGDSGGPLVTLK--NGIWWLIGDTSWGSGCAK 465

  Fly   344 PNYPGVYTRVTKYLDWIVENSR 365
            ...||||..||.:.|||.:..|
Mouse   466 ALRPGVYGNVTVFTDWIYQQMR 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 84/249 (34%)
Tryp_SPc 128..363 CDD:238113 85/251 (34%)
Tmprss2NP_056590.2 LDLa 112..147 CDD:238060
SRCR_2 152..247 CDD:373897 6/19 (32%)
Tryp_SPc 254..485 CDD:238113 85/251 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm11120
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.