DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and Prss33

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001102497.1 Gene:Prss33 / 497873 RGDID:1583742 Length:277 Species:Rattus norvegicus


Alignment Length:264 Identity:94/264 - (35%)
Similarity:133/264 - (50%) Gaps:39/264 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 CGERNDESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCVKGFMWFMIKVTFG 183
            ||:....||||||......|:||...:.:.....|||:||..::||||.||      |..:|...
  Rat    25 CGQPRMSSRIVGGRDAQDGEWPWQTSIQHRGAHVCGGSLIAPQWVLTAGHC------FSRRVLPS 83

  Fly   184 EH---------DRCNDKER--PETRFVLRAFSQKFSFSNFDNDIALLRLNDRVPITSFIRPICLP 237
            |:         |..:..|.  |..|.:|   ...:|......|:|||:|:..|.:::.|:|:|||
  Rat    84 EYSVLLGALSLDVTSSHELLVPVLRVLL---PPDYSEDEARGDLALLQLSHPVSLSARIQPVCLP 145

  Fly   238 RVEQRQDLFVGTKAIATGWGTLK-----EDGKPSCLLQEVEVPVLDNDEC------VAQTNYTQK 291
            .......  .|:....||||:|.     ..|:|   ||.|.||:||:..|      .|....:::
  Rat   146 APGSHPP--PGSPCWVTGWGSLSPGVPLPKGRP---LQGVRVPLLDSRACDRLYHMGANVPKSER 205

  Fly   292 MITKNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTKY 356
            ::....:|:||.. |.:|:|||||||||..:  :..|:..:|:||||.|||.||.|||||.|.||
  Rat   206 IVLPGNLCAGYRR-GHKDACQGDSGGPLTCM--ESGRWVLVGVVSWGKGCALPNRPGVYTNVAKY 267

  Fly   357 LDWI 360
            ..||
  Rat   268 SPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 89/254 (35%)
Tryp_SPc 128..363 CDD:238113 90/255 (35%)
Prss33NP_001102497.1 Tryp_SPc 33..271 CDD:214473 89/254 (35%)
Tryp_SPc 34..272 CDD:238113 90/255 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.