DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and prss27

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_031749235.1 Gene:prss27 / 496619 XenbaseID:XB-GENE-5744470 Length:724 Species:Xenopus tropicalis


Alignment Length:255 Identity:90/255 - (35%)
Similarity:134/255 - (52%) Gaps:15/255 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 SCRCGERNDESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCV-KGFMWFMIK 179
            |..||:.....|||||......|:||...:.|.|...|||:|::..:|::||||. :.:....::
 Frog   408 STGCGQPAFSDRIVGGNNAVFGEWPWQVSIVYQNSHICGGSLVSSNWVVSAAHCFPRSYKIENMQ 472

  Fly   180 VTFGEHDRCNDKERPETRFVLRAFSQK-FSFSNFDNDIALLRLNDRVPITSFIRPICLPRVEQRQ 243
            |..|.....|.........|.|..:.. ::......|||::.:...|..:|:|.|||:|..  .:
 Frog   473 VLLGCFALMNLTSDAVIIRVKRVITYPLYTGEGSSGDIAMVEMESPVTYSSYILPICIPLT--NE 535

  Fly   244 DLFVGTKAIATGWGTLKEDG--KPSCLLQEVEVPVLDNDECVAQTNYTQ------KMITKNMMCS 300
            |...|.....||||.::.|.  .|...|||||||:::...|....:|..      :::..:|:|:
 Frog   536 DFPSGKMCWVTGWGNIQSDVSLSPPYPLQEVEVPLVNASSCDTMYHYNSDLNPATQLVHDDMICA 600

  Fly   301 GYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTKYLDWI 360
            ||| .|.:|:|||||||||. .:..:..| ..||||||:|||:||.|||||:|:.:..||
 Frog   601 GYP-EGQKDACQGDSGGPLA-CKSGNYWF-LTGIVSWGDGCAQPNRPGVYTKVSSFSSWI 657

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 85/242 (35%)
Tryp_SPc 128..363 CDD:238113 86/243 (35%)
prss27XP_031749235.1 Tryp_SPc 34..271 CDD:238113
Tryp_SPc 420..659 CDD:238113 86/243 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 183 1.000 Inparanoid score I3837
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.