DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and AgaP_AGAP004740

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_001231095.2 Gene:AgaP_AGAP004740 / 4576567 VectorBaseID:AGAP004740 Length:258 Species:Anopheles gambiae


Alignment Length:274 Identity:75/274 - (27%)
Similarity:116/274 - (42%) Gaps:56/274 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 CSCRCGE----RNDESRIVGGTTTGVSEYPWMARLSYFNR----FYCGGTLINDRYVLTAAHCVK 171
            |....||    ||  ||||.|  ...:..|:.|.:.|.|.    |:.||:||:||:|||||..:.
Mosquito    15 CCVSAGEISLDRN--SRIVNG--LNAANTPYNAYVLYLNSANSGFFGGGSLISDRHVLTAAQNIA 75

  Fly   172 GFMWFMI---KVTFGEHDRCNDKERPETRFVLRAFSQ-----KFSFSNFDNDIALLRLNDRVPIT 228
            ||:.:.:   ...||:.:             ::..||     .|:.:|..|||..:.|...:..|
Mosquito    76 GFVRWEVGLGSTVFGQLN-------------IQISSQAVAHPSFNMANRANDIGFIVLPQPIVFT 127

  Fly   229 SFIRPICLPRVEQRQDLFVGTKAIATGWGTLKEDGK-PSCLLQEVEVPVLDNDECVAQTNYTQKM 292
            :.|.||.|| ::.|...:...:.:..|:|.....|: .|..|:.....|:.:..||.    ..::
Mosquito   128 ALISPIQLP-IQGRNLPYENEEGMIVGFGFNSVGGQVRSDFLKVGYQRVISDSRCVG----IYQI 187

  Fly   293 ITKNMMCSGYPGVGGRDS------CQGDSGGPLVRLRPDDKRFEQ-IGIVSWGNGCARPNYPGVY 350
            ...|..|:       .||      |.||.|...|   ..|:|.:. :|:.|..........|..|
Mosquito   188 TLPNHFCA-------EDSVMRSNVCNGDLGAGFV---VSDRRIDTLVGVASLITASCDSTSPTGY 242

  Fly   351 TRVTKYLDWIVENS 364
            |||::|..||.:|:
Mosquito   243 TRVSQYRQWIRDNT 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 66/252 (26%)
Tryp_SPc 128..363 CDD:238113 67/254 (26%)
AgaP_AGAP004740XP_001231095.2 Tryp_SPc 29..252 CDD:214473 66/252 (26%)
Tryp_SPc 30..255 CDD:238113 67/254 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.