DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and MST1

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001380510.1 Gene:MST1 / 4485 HGNCID:7380 Length:737 Species:Homo sapiens


Alignment Length:438 Identity:103/438 - (23%)
Similarity:162/438 - (36%) Gaps:131/438 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FTAATSATP-------ATPATPATSAPPAT-----------STATSSLSSIPGKYQALGAAHHQA 67
            |...::.||       |:...||.:.|.||           .|||::        |....|...|
Human   340 FGRTSAGTPTAQRRPGASHCGPACARPFATRSGVVQTTCGPRTATTA--------QGSSTAARSA 396

  Fly    68 KKLKIGDVNA------SSSDANKPVFRQNPIKNWFGAFNRNNS----------PAA----QNQTS 112
            :..::...:|      :|..:..|   .|.:.||     |..|          |.|    |...|
Human   397 RPARVSSASAGPLRRRTSRSSRLP---PNRMHNW-----RRTSAGTQMGIAMGPGATRWTQGPHS 453

  Fly   113 PTCSC----------------RCGERNDESRIVGGTTTGVSEYPWM-----------------AR 144
            .|..|                ||..|: .:|...|..:||....|:                 |:
Human   454 TTVPCDAALMTSRHQSWTPQTRCSLRS-VARGWIGWISGVPSCAWLGAIRATHPGQSACGIGEAQ 517

  Fly   145 LSYFNR-------FYCGGTLINDRYVLTAAHC-------VKGF-MWFMIKVTFGEHDRCNDKERP 194
            |...:|       .:|||:|:.::::|||..|       :.|: :|........:|...:.:..|
Human   518 LPVSHREELRQGQHFCGGSLVKEQWILTARQCFSSCHMPLTGYEVWLGTLFQNPQHGEPSLQRVP 582

  Fly   195 ETRFVLRAFSQKFSFSNFDNDIALLRLNDRVPITSFIRPICLPRVEQRQDLFV---GTKAIATGW 256
            ..:.|.         ....:.:.||:|...|.:...:..||||     .:.:|   |||....||
Human   583 VAKMVC---------GPSGSQLVLLKLERSVTLNQRVALICLP-----PEWYVVPPGTKCEIAGW 633

  Fly   257 GTLKEDGKPSCLLQEVEVPVLDNDECVAQTNYTQK-MITKNMMCS-GYPGVGGRDSCQGDSGGPL 319
            |..|..|..: :|....:.|:.|.||    |...: .:.::.||: |.....|  :|:||.||||
Human   634 GETKGTGNDT-VLNVALLNVISNQEC----NIKHRGRVRESEMCTEGLLAPVG--ACEGDYGGPL 691

  Fly   320 VRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTKYLDWIVENSRDG 367
            .....:....|  ||:.....|||..:|.|:|||:.::|||.:..|.|
Human   692 ACFTHNCWVLE--GIIIPNRVCARSRWPAVFTRVSVFVDWIHKVMRLG 737

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 67/269 (25%)
Tryp_SPc 128..363 CDD:238113 68/271 (25%)
MST1NP_001380510.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.