DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and zgc:92313

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001002596.1 Gene:zgc:92313 / 436869 ZFINID:ZDB-GENE-040718-339 Length:309 Species:Danio rerio


Alignment Length:262 Identity:90/262 - (34%)
Similarity:138/262 - (52%) Gaps:36/262 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 CGERNDESRIVGGTTTGVSEYPWMARL-SYFNRFYCGGTLINDRYVLTAAHC------VKGFMWF 176
            ||.....:|||||::.....:||...: ...::..||||:|::.:||:||||      :.|::  
Zfish    26 CGRPPMINRIVGGSSAADGAWPWQVDIQGEKSKHVCGGTIISENWVLSAAHCFPNPNDISGYL-- 88

  Fly   177 MIKVTFGEHDRCNDKERPETRFVLRAFSQKFSFSN--FDNDIALLRLNDRVPITSFIRPICLP-- 237
                .:....:.|.....||...:........:::  ...||||:.|......|..|:|:|||  
Zfish    89 ----IYAGRQQLNGWNPDETSHRISRVVVPLGYTDPQLGQDIALVELATPFVYTERIQPVCLPYA 149

  Fly   238 RVEQRQDLFVGTKAIATGWGTLKED------GKPSCLLQEVEVPVLDNDEC--VAQTNYTQKM-I 293
            .||...|:    :.:.||||.::|.      |.    ||||:||::|:..|  :..||.|:.: |
Zfish   150 NVEFTSDM----RCMITGWGDIREGVALQGVGP----LQEVQVPIIDSQICQDMFLTNPTENIDI 206

  Fly   294 TKNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTKYLD 358
            ..:|||:|:. .||:|||||||||||. .:..|..:.|.||||:|.|||..|.||||.:|:.:.:
Zfish   207 RPDMMCAGFQ-QGGKDSCQGDSGGPLA-CQISDGSWVQAGIVSFGLGCAEANRPGVYAKVSSFTN 269

  Fly   359 WI 360
            :|
Zfish   270 FI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 87/252 (35%)
Tryp_SPc 128..363 CDD:238113 87/253 (34%)
zgc:92313NP_001002596.1 Tryp_SPc 34..271 CDD:214473 87/252 (35%)
Tryp_SPc 35..274 CDD:238113 87/253 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.