DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and CG9733

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:355 Identity:120/355 - (33%)
Similarity:162/355 - (45%) Gaps:64/355 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 QALGAAHHQAKKLKIGDVNASSSD--ANKP---VFRQNPIKNW-FGAFNRNNSPAA------QNQ 110
            |..|....|.:.....|..|...|  ..:|   ||.:...:.| ||     |.||.      ::.
  Fly    80 QDTGYVRIQRQDRTFPDYGAFGGDWEEERPQSFVFPRQERRPWSFG-----NQPATSRTPFRKSS 139

  Fly   111 TSPTCSC-----RCGERNDESRIVGGTTTGVSEYPWMARLSYFNR------FYCGGTLINDRYVL 164
            ||...|.     .||.....:||..|..|.|:|:|||..|.|..|      ..|.|:|||.||||
  Fly   140 TSDGSSLLPQPPSCGGVGIRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVL 204

  Fly   165 TAAHCVKG----FMWFMIKVTFGEHDRCNDKERP----------------ETRFVLRAFSQKFSF 209
            |||||:.|    .:..::.|..||||.....:.|                |.| |...:|:|  .
  Fly   205 TAAHCLTGRIEREVGTLVSVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIR-VHERYSEK--A 266

  Fly   210 SNFDNDIALLRLNDRVPITSFIRPICLPR---VEQRQDLFVGTKAIATGWG-TLKEDGKPSCLLQ 270
            ||..:||.|:|:...|..:..|:|||||.   :|.||.   |.:....||| |||.  ..|.:.|
  Fly   267 SNQVHDIGLIRMERNVRYSDNIQPICLPSSVGLESRQS---GQQFTVAGWGRTLKM--ARSAVKQ 326

  Fly   271 EVEVPVLDNDECVAQTNYTQKMITKNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIGIV 335
            :|.|..:|..:|..:.:..:..:....:|:|  |...:|||.|||||||:|.|  |:.:...|||
  Fly   327 KVTVNYVDPAKCRQRFSQIKVNLEPTQLCAG--GQFRKDSCDGDSGGPLMRFR--DESWVLEGIV 387

  Fly   336 SWGNGCARPNYPGVYTRVTKYLDWIVENSR 365
            |:|..|...::|||||.|..|..||.:|.|
  Fly   388 SFGYKCGLKDWPGVYTNVAAYDIWIRQNVR 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 96/262 (37%)
Tryp_SPc 128..363 CDD:238113 97/264 (37%)
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 96/262 (37%)
Tryp_SPc 162..415 CDD:238113 97/264 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.