DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and Tmprss11c

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001025468.1 Gene:Tmprss11c / 435845 MGIID:3521861 Length:431 Species:Mus musculus


Alignment Length:327 Identity:116/327 - (35%)
Similarity:157/327 - (48%) Gaps:78/327 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 KPVFRQNPIKNWFGA----------------------FNRNNSPAAQNQTSPTCSCRCGER---N 123
            |..:|.|..|.|...                      |:....|.|::..: ||   ||.|   :
Mouse   135 KACYRNNVEKYWESVETTLYQKLKGQTGLLIDSSSFKFSDIAMPIAEDLLN-TC---CGRRTIIH 195

  Fly   124 DESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCVKGFM-------WFMIKVT 181
            ...::.||......|:||.|.|...:...||.|||::.:::|||||   |:       |   ||:
Mouse   196 RGHKVAGGQDAEEGEWPWQASLQQNSVHRCGATLISNYWLITAAHC---FIRAANPKDW---KVS 254

  Fly   182 FGEHDRCNDKERPETRFVL------RA-----FSQKFSFSNFDNDIALLRLNDRVPITSFIRPIC 235
            ||              |:|      ||     ..:.:|:...|||||::||:..|...|.||..|
Mouse   255 FG--------------FLLSKPQAPRAVKNIIIHENYSYPAHDNDIAVVRLSSPVLYESNIRRAC 305

  Fly   236 LPRVEQRQDLFVGTKAIATGWGTLKEDGKPSCLLQEVEVPVLDNDECVAQTNYTQKMITKNMMCS 300
            ||  |..|.....:..:.|||||||.||....:||:.:|.::||..|.:...| ..|||..|||:
Mouse   306 LP--EATQKFPPNSDVVVTGWGTLKSDGDSPNILQKGKVKIIDNKTCNSGKAY-GGMITPGMMCA 367

  Fly   301 GYPGVGGR-DSCQGDSGGPLVRLRPDDKR--FEQIGIVSWGNGCARPNYPGVYTRVTKYLDWIVE 362
            |:  :.|| |:||||||||||   .:|.:  :...||||||:.||.||.||||||||.|.|||..
Mouse   368 GF--LKGRVDACQGDSGGPLV---SEDSKGIWFLAGIVSWGDECALPNKPGVYTRVTYYRDWITS 427

  Fly   363 NS 364
            .:
Mouse   428 KT 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 101/253 (40%)
Tryp_SPc 128..363 CDD:238113 103/255 (40%)
Tmprss11cNP_001025468.1 SEA 62..157 CDD:279699 5/21 (24%)
Tryp_SPc 199..425 CDD:214473 101/253 (40%)
Tryp_SPc 200..428 CDD:238113 103/255 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 179 1.000 Inparanoid score I3995
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.