DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and CG7142

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster


Alignment Length:346 Identity:89/346 - (25%)
Similarity:147/346 - (42%) Gaps:75/346 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 STATSSLSSIP-----GKYQALGAAHHQAKKL-KIGDVNASSSDANKPVFRQNPIKNWFGAFNRN 102
            |:|:|....:|     |..::.||||..|..| ..|.:....|....|  ||.   :|...|   
  Fly    24 SSASSGSIQLPTVRKCGGGRSAGAAHTMAMNLAAYGLLENRISTLEAP--RQT---HWTKKF--- 80

  Fly   103 NSPAAQNQTSPTCSCRCGERNDESRIVGGTTTGVSEYPWMARLSYFNR-----FYCGGTLINDRY 162
               .|:.:.:|..:                       |::..:.....     .||.||:||:.:
  Fly    81 ---LAKREATPHSA-----------------------PYVVSIQMMTPDQGLVHYCAGTIINEHW 119

  Fly   163 VLTAAHC------VKGFMWFMIKVTFGEHDRCNDKERPETRFVLRAFSQKFSFSNF-----DNDI 216
            :||||||      |:..:     :..|.|| .:|::...:...:|..........:     ..||
  Fly   120 ILTAAHCLSSPQAVENSV-----IVAGSHD-IHDQKGEASNIQMRHIDYYVRHELYLGGVNPYDI 178

  Fly   217 ALLRLNDRVPITSFIRPICLPRVEQRQDLFVGTKAIATGWGTLKEDGKPSC--LLQEVEVPVLDN 279
            ||:...:.:...::::|..||..:.:.:.: ||   ..|||.:.....|:.  .|||..:|:||.
  Fly   179 ALIYTKEPLVFDTYVQPATLPEQDAQPEGY-GT---LYGWGNVSMTAVPNYPHRLQEANMPILDM 239

  Fly   280 DECVAQTNYTQKMITKNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQ----IGIVSWGN- 339
            :.|......:...:.:..:|:| |..||...|..||||||:: :..::.|||    |||||||. 
  Fly   240 ELCEQILARSGLPLHETNLCTG-PLTGGVSICTADSGGPLIQ-QCCEEHFEQANIVIGIVSWGKM 302

  Fly   340 GCARPNYPGVYTRVTKYLDWI 360
            .|.:.|.|.|:.||:.:.:||
  Fly   303 PCGQKNAPSVFVRVSAFTEWI 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 67/255 (26%)
Tryp_SPc 128..363 CDD:238113 69/256 (27%)
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 70/275 (25%)
Tryp_SPc 84..323 CDD:214473 68/273 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.